Lineage for d6p43b_ (6p43 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
    Uniprot P00044
  8. 2691096Domain d6p43b_: 6p43 B: [376158]
    Other proteins in same PDB: d6p43a_, d6p43c_
    automated match to d2bcnb_
    complexed with hem

Details for d6p43b_

PDB Entry: 6p43 (more details), 1.91 Å

PDB Description: yeast cytochrome c peroxidase in complex with iso-1 cytochrome c (y48k)
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d6p43b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p43b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysktdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d6p43b_:

Click to download the PDB-style file with coordinates for d6p43b_.
(The format of our PDB-style files is described here.)

Timeline for d6p43b_: