Lineage for d1gc6a3 (1gc6 A:1-87)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. Protein Radixin [54259] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries)
  8. Domain d1gc6a3: 1gc6 A:1-87 [37614]
    Other proteins in same PDB: d1gc6a1, d1gc6a2
    complexed with i3p

Details for d1gc6a3

PDB Entry: 1gc6 (more details), 2.9 Å

PDB Description: crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d1gc6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc6a3 d.15.1.4 (A:1-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
mpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlk
lnkkvtqqdvkkenplqfkfrakffpe

SCOPe Domain Coordinates for d1gc6a3 are not available.

Timeline for d1gc6a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gc6a1, d1gc6a2