Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.4: First domain of FERM [54256] (7 proteins) |
Protein Moesin [54257] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54258] (3 PDB entries) Uniprot P26038 4-297 |
Domain d1ef1b3: 1ef1 B:4-87 [37612] Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1b1, d1ef1b2, d1ef1c_, d1ef1d_ complexed with so4 |
PDB Entry: 1ef1 (more details), 1.9 Å
SCOPe Domain Sequences for d1ef1b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef1b3 d.15.1.4 (B:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk kvtaqdvrkespllfkfrakfype
Timeline for d1ef1b3: