Lineage for d1ef1b3 (1ef1 B:4-87)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 407835Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 407958Family d.15.1.4: First domain of FERM [54256] (5 proteins)
  6. 407974Protein Moesin [54257] (1 species)
  7. 407975Species Human (Homo sapiens) [TaxId:9606] [54258] (2 PDB entries)
  8. 407977Domain d1ef1b3: 1ef1 B:4-87 [37612]
    Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1b1, d1ef1b2, d1ef1c_, d1ef1d_
    complexed with so4

Details for d1ef1b3

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1b3 d.15.1.4 (B:4-87) Moesin {Human (Homo sapiens)}
tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
kvtaqdvrkespllfkfrakfype

SCOP Domain Coordinates for d1ef1b3:

Click to download the PDB-style file with coordinates for d1ef1b3.
(The format of our PDB-style files is described here.)

Timeline for d1ef1b3: