SCOP 1.63: Domain d1ef1b3: 1ef1 B:4-87

Lineage for d1ef1b3 (1ef1 B:4-87)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (6 families)

5. Family d.15.1.4: First domain of FERM [54256] (5 proteins)

6. Protein Moesin [54257] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54258] (2 PDB entries)

8. Domain d1ef1b3: 1ef1 B:4-87 [37612]
   Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1b1, d1ef1b2, d1ef1c_, d1ef1d_
   complexed with so4

Details for d1ef1b3

PDB Entry: 1ef1, 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1b3:

Sequence; same for both SEQRES and ATOM records:

>d1ef1b3 d.15.1.4 (B:4-87) Moesin {Human (Homo sapiens)}
tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
kvtaqdvrkespllfkfrakfype

Timeline for d1ef1b3:

• d1ef1b3 first appeared (with stable ids) in SCOP 1.55
  
• d1ef1b3 appears in SCOP 1.61
  
• d1ef1b3 appears in SCOP 1.65
  
• d1ef1b3 appears in the current release, SCOPe 2.08