![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (5 families) ![]() |
![]() | Family d.15.1.4: First domain of FERM [54256] (3 proteins) |
![]() | Protein Moesin [54257] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54258] (1 PDB entry) |
![]() | Domain d1ef1b3: 1ef1 B:4-87 [37612] Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1b1, d1ef1b2, d1ef1c_, d1ef1d_ |
PDB Entry: 1ef1 (more details), 1.9 Å
SCOP Domain Sequences for d1ef1b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef1b3 d.15.1.4 (B:4-87) Moesin {Human (Homo sapiens)} tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk kvtaqdvrkespllfkfrakfype
Timeline for d1ef1b3: