Lineage for d6op7a_ (6op7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996868Species Enterobacter cloacae [TaxId:550] [226695] (4 PDB entries)
  8. 2996870Domain d6op7a_: 6op7 A: [376112]
    automated match to d5lsca_
    complexed with act, zn

Details for d6op7a_

PDB Entry: 6op7 (more details), 1.37 Å

PDB Description: structure of oxidized vim-20
PDB Compounds: (A:) Metallo-beta-lactamase VIM-20

SCOPe Domain Sequences for d6op7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6op7a_ d.157.1.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
yptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgaknt
aallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneipt
hsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnva
dadlaewptsieriqqrypeaqfvipghglpggldllkhttnvvkahtn

SCOPe Domain Coordinates for d6op7a_:

Click to download the PDB-style file with coordinates for d6op7a_.
(The format of our PDB-style files is described here.)

Timeline for d6op7a_: