SCOP 1.55: Domain d1ef1a3: 1ef1 A:4-87

Lineage for d1ef1a3 (1ef1 A:4-87)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.1: Ubiquitin-like [54236] (5 families)

5. Family d.15.1.4: First domain of FERM [54256] (3 proteins)

6. Protein Moesin [54257] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54258] (1 PDB entry)

8. Domain d1ef1a3: 1ef1 A:4-87 [37611]
   Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1b1, d1ef1b2, d1ef1c_, d1ef1d_

Details for d1ef1a3

PDB Entry: 1ef1, 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1a3:

Sequence; same for both SEQRES and ATOM records:

>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens)}
tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
kvtaqdvrkespllfkfrakfype

Timeline for d1ef1a3:

• d1ef1a3 appears in SCOP 1.57
  
• d1ef1a3 appears in the current release, SCOPe 2.08