Lineage for d6p41c_ (6p41 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719985Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2719986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
    Uniprot P00431
  8. 2720211Domain d6p41c_: 6p41 C: [376098]
    Other proteins in same PDB: d6p41b_, d6p41d_
    automated match to d5ciha_
    complexed with hem

Details for d6p41c_

PDB Entry: 6p41 (more details), 2.9 Å

PDB Description: yeast cytochrome c peroxidase (w191y:l232e) in complex with iso-1 cytochrome c
PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d6p41c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p41c_ a.93.1.1 (C:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpygaannvftnefylnllnedwklekndanneqwdsksgymmeptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d6p41c_:

Click to download the PDB-style file with coordinates for d6p41c_.
(The format of our PDB-style files is described here.)

Timeline for d6p41c_: