Lineage for d6hvfa_ (6hvf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979972Protein c-src tyrosine kinase [56155] (3 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2979973Species Chicken (Gallus gallus) [TaxId:9031] [56157] (56 PDB entries)
  8. 2980021Domain d6hvfa_: 6hvf A: [376095]
    automated match to d2hwoa_
    complexed with edo, gut

Details for d6hvfa_

PDB Entry: 6hvf (more details), 2.1 Å

PDB Description: kinase domain of csrc in complex with compound 29b
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d6hvfa_:

Sequence, based on SEQRES records: (download)

>d6hvfa_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivmeymskgclldflkgemgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d6hvfa_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqggevwmgtwngttrvaiktflqeaqvmkklrheklvqlyav
vseepiyivmeymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlr
aanilvgenlvckvadfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmv
nrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqy
qpgenl

SCOPe Domain Coordinates for d6hvfa_:

Click to download the PDB-style file with coordinates for d6hvfa_.
(The format of our PDB-style files is described here.)

Timeline for d6hvfa_: