Lineage for d6oq1a_ (6oq1 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (17 species)
    not a true protein
  7. 2502047Species House fly (Musca domestica) [TaxId:7370] [341246] (2 PDB entries)
  8. 3076027Domain d6oq1a_: 6oq1 A: [376089]
    Other proteins in same PDB: d6oq1c_, d6oq1d_, d6oq1e_, d6oq1f_
    automated match to d5o44a_

Details for d6oq1a_

PDB Entry: 6oq1 (more details), 2.2 Å

PDB Description: crystal structure of branched k11/k48-linked tri-ubiquitin
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d6oq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oq1a_ d.15.1.1 (A:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagcqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d6oq1a_:

Click to download the PDB-style file with coordinates for d6oq1a_.
(The format of our PDB-style files is described here.)

Timeline for d6oq1a_:

  • d6oq1a_ is new in SCOPe 2.07-stable