SCOPe 2.07: Domain d6mswb_: 6msw B:

Lineage for d6mswb_ (6msw B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [375292] (2 PDB entries)

8. Domain d6mswb_: 6msw B: [376086]
   automated match to d5h91a_
   complexed with gol; mutant

Details for d6mswb_

PDB Entry: 6msw, 2.17 Å

PDB Description: crystal structure of bh1352 2-deoxyribose-5-phosphate from bacillus halodurans, k184l mutant

PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d6mswb_:

Sequence; same for both SEQRES and ATOM records:

>d6mswb_ c.1.10.0 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
siaqmidhtllkpnttedqivklceeakeysfasvcvnptwvalaaqllkdapdvkvctv
igfplgattpevkafettnaiengatevdmvinigalkdkqyelvgrdiqavvkaaegka
ltkviietsllteeekkaacelavkagadfvktstgfsgggataedialmrkvvgpnlgv
lasggvrdlsdakamidagatrigasagvaivngersegsy

Timeline for d6mswb_:

• d6mswb_ is new in SCOPe 2.07-stable
  
• d6mswb_ appears in the current release, SCOPe 2.08