Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [375292] (2 PDB entries) |
Domain d6mswe_: 6msw E: [376082] automated match to d5h91a_ complexed with gol; mutant |
PDB Entry: 6msw (more details), 2.17 Å
SCOPe Domain Sequences for d6mswe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mswe_ c.1.10.0 (E:) automated matches {Bacillus halodurans [TaxId: 272558]} rsiaqmidhtllkpnttedqivklceeakeysfasvcvnptwvalaaqllkdapdvkvct vigfplgattpevkafettnaiengatevdmvinigalkdkqyelvgrdiqavvkaaegk altkviietsllteeekkaacelavkagadfvktstgfsgggataedialmrkvvgpnlg vlasggvrdlsdakamidagatrigasagvaivnger
Timeline for d6mswe_: