Lineage for d6oq1c_ (6oq1 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Ubiquitin [54238] (9 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54239] (309 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. Domain d6oq1c_: 6oq1 C: [376080]
    automated match to d1zgub1

Details for d6oq1c_

PDB Entry: 6oq1 (more details), 2.2 Å

PDB Description: crystal structure of branched k11/k48-linked tri-ubiquitin
PDB Compounds: (C:) Ubiquitin

SCOPe Domain Sequences for d6oq1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oq1c_ d.15.1.1 (C:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d6oq1c_ are not available.

Timeline for d6oq1c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6oq1a_, d6oq1b_, d6oq1d_, d6oq1e_, d6oq1f_