Lineage for d6hpsb_ (6hps B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019437Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 3019438Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 3019439Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 3019507Protein automated matches [193584] (2 species)
    not a true protein
  7. 3019508Species Firefly (Photinus pyralis) [TaxId:7054] [193585] (11 PDB entries)
  8. 3019525Domain d6hpsb_: 6hps B: [376069]
    automated match to d4g36b_
    complexed with gkh

Details for d6hpsb_

PDB Entry: 6hps (more details), 3.1 Å

PDB Description: near-infrared dual bioluminescence imaging in vivo using infra- luciferin
PDB Compounds: (B:) Luciferin 4-monooxygenase

SCOPe Domain Sequences for d6hpsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hpsb_ e.23.1.1 (B:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
esfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpf
hhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidk
ydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavg
kvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdi
aywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaa
vvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak
kgg

SCOPe Domain Coordinates for d6hpsb_:

Click to download the PDB-style file with coordinates for d6hpsb_.
(The format of our PDB-style files is described here.)

Timeline for d6hpsb_: