Lineage for d1vcbj_ (1vcb J:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402170Protein Elongin B [54246] (2 species)
  7. 1402171Species Human (Homo sapiens) [TaxId:9606] [54247] (16 PDB entries)
  8. 1402202Domain d1vcbj_: 1vcb J: [37606]
    Other proteins in same PDB: d1vcbb_, d1vcbc_, d1vcbe_, d1vcbf_, d1vcbh_, d1vcbi_, d1vcbk_, d1vcbl_

Details for d1vcbj_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure
PDB Compounds: (J:) protein (elongin b)

SCOPe Domain Sequences for d1vcbj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppe

SCOPe Domain Coordinates for d1vcbj_:

Click to download the PDB-style file with coordinates for d1vcbj_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbj_: