Lineage for d1vcbg_ (1vcb G:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77789Superfamily d.15.1: Ubiquitin-like [54236] (5 families) (S)
  5. 77790Family d.15.1.1: Ubiquitin-related [54237] (5 proteins)
  6. 77791Protein Elongin B [54246] (1 species)
  7. 77792Species Human (Homo sapiens) [TaxId:9606] [54247] (1 PDB entry)
  8. 77795Domain d1vcbg_: 1vcb G: [37605]
    Other proteins in same PDB: d1vcbb_, d1vcbc_, d1vcbe_, d1vcbf_, d1vcbh_, d1vcbi_, d1vcbk_, d1vcbl_

Details for d1vcbg_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure
PDB Compounds: (G:)

SCOP Domain Sequences for d1vcbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens)}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppe

SCOP Domain Coordinates for d1vcbg_:

Click to download the PDB-style file with coordinates for d1vcbg_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbg_: