SCOPe 2.07: Domain d6ke2a_: 6ke2 A:

Lineage for d6ke2a_ (6ke2 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (50 PDB entries)

8. Domain d6ke2a_: 6ke2 A: [376043]
   automated match to d5up8a_
   complexed with ca, cl, fe, mg

Details for d6ke2a_

PDB Entry: 6ke2, 1.8 Å

PDB Description: abloop reengineered ferritin nanocage

PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d6ke2a_:

Sequence; same for both SEQRES and ATOM records:

>d6ke2a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrvalknfakyflhqsheerehae
klmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdkndp
hlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d6ke2a_:

• d6ke2a_ is new in SCOPe 2.07-stable
  
• d6ke2a_ appears in the current release, SCOPe 2.08