Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (17 proteins) |
Protein Nedd8 [54244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54245] (3 PDB entries) |
Domain d1nddd_: 1ndd D: [37602] |
PDB Entry: 1ndd (more details), 1.6 Å
SCOP Domain Sequences for d1nddd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nddd_ d.15.1.1 (D:) Nedd8 {Human (Homo sapiens)} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlal
Timeline for d1nddd_: