Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (158 PDB entries) |
Domain d6knzf2: 6knz F:77-378 [376016] Other proteins in same PDB: d6knza1, d6knza2, d6knzb1, d6knzb2, d6knzc1, d6knzc2, d6knzd1, d6knzd2, d6knze_, d6knzf1, d6knzf3 automated match to d3tiia2 complexed with acp, ca, dn0, gdp, gtp, mes, mg |
PDB Entry: 6knz (more details), 2.48 Å
SCOPe Domain Sequences for d6knzf2:
Sequence, based on SEQRES records: (download)
>d6knzf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d6knzf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwiakssagakge gilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyre gvlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalntt lensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapac aqklyaelcqgivdvaissvfplatsifikl
Timeline for d6knzf2: