Lineage for d1nddc_ (1ndd C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931416Protein Nedd8 [54244] (1 species)
  7. 2931417Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2931421Domain d1nddc_: 1ndd C: [37601]
    complexed with cl, so4

Details for d1nddc_

PDB Entry: 1ndd (more details), 1.6 Å

PDB Description: structure of nedd8
PDB Compounds: (C:) protein (ubiquitin-like protein nedd8)

SCOPe Domain Sequences for d1nddc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nddc_ d.15.1.1 (C:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlal

SCOPe Domain Coordinates for d1nddc_:

Click to download the PDB-style file with coordinates for d1nddc_.
(The format of our PDB-style files is described here.)

Timeline for d1nddc_: