SCOPe 2.08: Domain d6hs8a1: 6hs8 A:1-142

Lineage for d6hs8a1 (6hs8 A:1-142)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families)

5. Family c.23.13.0: automated matches [191662] (1 protein)
   not a true family

6. Protein automated matches [191250] (6 species)
   not a true protein

7. Species Butyrivibrio crossotus [TaxId:511680] [375999] (3 PDB entries)

8. Domain d6hs8a1: 6hs8 A:1-142 [376005]
   Other proteins in same PDB: d6hs8a2
   automated match to d1d0ie_
   complexed with gol, po4, tla

Details for d6hs8a1

PDB Entry: 6hs8, 1.7 Å

PDB Description: the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d6hs8a1:

Sequence; same for both SEQRES and ATOM records:

>d6hs8a1 c.23.13.0 (A:1-142) automated matches {Butyrivibrio crossotus [TaxId: 511680]}
mkilvingpnlnflgirekniygnenyeylvnmineycksknievecyqsnhegaiidki
qeayfngtdgivinpgaythysyairdalasvshikkievhisnvnereefrhisvtepv
cngqivgqglkgyimaidmlns

Timeline for d6hs8a1:

• d6hs8a1 first appeared in SCOPe 2.07