SCOPe 2.08: Domain d6il0a_: 6il0 A:

Lineage for d6il0a_ (6il0 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:64187] [188927] (16 PDB entries)

8. Domain d6il0a_: 6il0 A: [375993]
   automated match to d5cwxa_
   complexed with k3u, ni

Details for d6il0a_

PDB Entry: 6il0, 1.93 Å

PDB Description: k3u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d6il0a_:

Sequence, based on SEQRES records:

>d6il0a_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvlsy

Sequence, based on observed residues (ATOM records):

>d6il0a_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfpavpltalanaqieplsdemengwegclsipglravipryryiryrgfapdgspier
eaegfharvvqheydhlvgrlypsrienfdtfgfddvlsy

Timeline for d6il0a_:

• d6il0a_ first appeared in SCOPe 2.07