Lineage for d6hr6a1 (6hr6 A:50-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004526Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 3004527Protein automated matches [226981] (13 species)
    not a true protein
  7. 3004559Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [228776] (27 PDB entries)
  8. 3004589Domain d6hr6a1: 6hr6 A:50-221 [375988]
    Other proteins in same PDB: d6hr6a2, d6hr6a3
    automated match to d4weka1
    complexed with nef

Details for d6hr6a1

PDB Entry: 6hr6 (more details), 2.53 Å

PDB Description: nitrocefin reacted with catalytic serine (ser294) of penicillin- binding protein 3 from pseudomonas aeruginosa
PDB Compounds: (A:) Peptidoglycan D,D-transpeptidase FtsI

SCOPe Domain Sequences for d6hr6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hr6a1 d.175.1.0 (A:50-221) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
arsvrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtkl
fadrieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftd
vddrgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

SCOPe Domain Coordinates for d6hr6a1:

Click to download the PDB-style file with coordinates for d6hr6a1.
(The format of our PDB-style files is described here.)

Timeline for d6hr6a1: