Lineage for d1euvb_ (1euv B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 130888Superfamily d.15.1: Ubiquitin-like [54236] (5 families) (S)
  5. 130889Family d.15.1.1: Ubiquitin-related [54237] (5 proteins)
  6. 130905Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 130906Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54243] (1 PDB entry)
  8. 130907Domain d1euvb_: 1euv B: [37598]
    Other proteins in same PDB: d1euva_

Details for d1euvb_

PDB Entry: 1euv (more details), 1.6 Å

PDB Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.

SCOP Domain Sequences for d1euvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae)}
pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
dldmedndiieahreqigg

SCOP Domain Coordinates for d1euvb_:

Click to download the PDB-style file with coordinates for d1euvb_.
(The format of our PDB-style files is described here.)

Timeline for d1euvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1euva_