Lineage for d6il2a_ (6il2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001238Species Xanthomonas oryzae [TaxId:64187] [188927] (16 PDB entries)
  8. 3001250Domain d6il2a_: 6il2 A: [375978]
    automated match to d4nt8a_
    complexed with cd, lhy

Details for d6il2a_

PDB Entry: 6il2 (more details), 2.41 Å

PDB Description: k4u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d6il2a_:

Sequence, based on SEQRES records: (download)

>d6il2a_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvl

Sequence, based on observed residues (ATOM records): (download)

>d6il2a_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfavpltalanaqieplsdemengwegclsipglravipryryiryrgfapdgspiere
aegfharvvqheydhlvgrlypsrienfdtfgfddvl

SCOPe Domain Coordinates for d6il2a_:

Click to download the PDB-style file with coordinates for d6il2a_.
(The format of our PDB-style files is described here.)

Timeline for d6il2a_: