Class a: All alpha proteins [46456] (289 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries) Uniprot P02768 29-596 |
Domain d6hscb2: 6hsc B:197-388 [375972] automated match to d3uiva1 complexed with edo, goq, myr |
PDB Entry: 6hsc (more details), 1.9 Å
SCOPe Domain Sequences for d6hscb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hscb2 a.126.1.1 (B:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde fkplveepqnli
Timeline for d6hscb2: