Lineage for d1a5r__ (1a5r -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499526Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 499530Species Human (Homo sapiens) [TaxId:9606] [54242] (2 PDB entries)
  8. 499532Domain d1a5r__: 1a5r - [37597]

Details for d1a5r__

PDB Entry: 1a5r (more details)

PDB Description: structure determination of the small ubiquitin-related modifier sumo- 1, nmr, 10 structures

SCOP Domain Sequences for d1a5r__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5r__ d.15.1.1 (-) SUMO-1 (smt3 homologue) {Human (Homo sapiens)}
gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv

SCOP Domain Coordinates for d1a5r__:

Click to download the PDB-style file with coordinates for d1a5r__.
(The format of our PDB-style files is described here.)

Timeline for d1a5r__: