Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) |
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (63 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d1c3ta_: 1c3t A: [37594] designed hydrophobic core mutant |
PDB Entry: 1c3t (more details)
SCOP Domain Sequences for d1c3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3ta_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqlfvktltgktltvelepsdtvenlkakiqdkegippdqqrlifagkqledgrtlsdyn lqkestihlvlrlrgg
Timeline for d1c3ta_: