SCOPe 2.08: Domain d6udec2: 6ude C:254-499

Lineage for d6udec2 (6ude C:254-499)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Elizabethkingia anophelis [TaxId:1338011] [375927] (1 PDB entry)

8. Domain d6udec2: 6ude C:254-499 [375933]
   automated match to d3ezwe2
   complexed with adp, gol, mg

Details for d6udec2

PDB Entry: 6ude, 1.95 Å

PDB Description: crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol

PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d6udec2:

Sequence; same for both SEQRES and ATOM records:

>d6udec2 c.55.1.0 (C:254-499) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
mctkpgmvkntygtgcfllmntgneavysknnllttvawkingevsyalegsvfvggaai
qwlrdglkiihdssevstlaetvednggvyfvpaltglgapywdqyargtiigvtrgttd
ghiaratlegiafqvydivkameadaetqstelrvdggasasnllmqiqsdlfgfkiirp
ktlettalgaaylaglavgfwesideiqsqwiiekeftpkedktkidnmvsfwhkavkrs
qawied

Timeline for d6udec2:

• d6udec2 first appeared in SCOPe 2.07