Lineage for d1ud7a_ (1ud7 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717214Protein Ubiquitin [54238] (3 species)
  7. 717220Species Human (Homo sapiens) [TaxId:9606] [54239] (47 PDB entries)
    identical sequence in many other species
  8. 717295Domain d1ud7a_: 1ud7 A: [37593]
    designed hydrophobic core mutant

Details for d1ud7a_

PDB Entry: 1ud7 (more details)

PDB Description: solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7
PDB Compounds: (A:) protein (ubiquitin core mutant 1d7)

SCOP Domain Sequences for d1ud7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud7a_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqvflktltgktvtievepsdtvenfkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestihlvlrlrgg

SCOP Domain Coordinates for d1ud7a_:

Click to download the PDB-style file with coordinates for d1ud7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ud7a_: