Lineage for d1ud7a_ (1ud7 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Ubiquitin [54238] (9 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54239] (309 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. Domain d1ud7a_: 1ud7 A: [37593]
    designed hydrophobic core mutant
    mutant

Details for d1ud7a_

PDB Entry: 1ud7 (more details)

PDB Description: solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7
PDB Compounds: (A:) protein (ubiquitin core mutant 1d7)

SCOPe Domain Sequences for d1ud7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud7a_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqvflktltgktvtievepsdtvenfkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestihlvlrlrgg

SCOPe Domain Coordinates for d1ud7a_ are not available.

Timeline for d1ud7a_: