Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Elizabethkingia anophelis [TaxId:1338011] [375927] (1 PDB entry) |
Domain d6udeb2: 6ude B:254-499 [375929] automated match to d3ezwe2 complexed with adp, gol, mg |
PDB Entry: 6ude (more details), 1.95 Å
SCOPe Domain Sequences for d6udeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6udeb2 c.55.1.0 (B:254-499) automated matches {Elizabethkingia anophelis [TaxId: 1338011]} mctkpgmvkntygtgcfllmntgneavysknnllttvawkingevsyalegsvfvggaai qwlrdglkiihdssevstlaetvednggvyfvpaltglgapywdqyargtiigvtrgttd ghiaratlegiafqvydivkameadaetqstelrvdggasasnllmqiqsdlfgfkiirp ktlettalgaaylaglavgfwesideiqsqwiiekeftpkedktkidnmvsfwhkavkrs qawied
Timeline for d6udeb2: