SCOPe 2.07: Domain d6sw3b1: 6sw3 B:1081-1197

Lineage for d6sw3b1 (6sw3 B:1081-1197)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)

8. Domain d6sw3b1: 6sw3 B:1081-1197 [375891]
   Other proteins in same PDB: d6sw3b2
   automated match to d4nyxa_
   mutant

Details for d6sw3b1

PDB Entry: 6sw3, 1.2 Å

PDB Description: crystal structure of crebbp bromodomain l1109w mutant

PDB Compounds: (B:) cDNA FLJ57039, highly similar to CREB-binding protein

SCOPe Domain Sequences for d6sw3b1:

Sequence; same for both SEQRES and ATOM records:

>d6sw3b1 a.29.2.1 (B:1081-1197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeswpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d6sw3b1:

• d6sw3b1 is new in SCOPe 2.07-stable
  
• d6sw3b1 appears in the current release, SCOPe 2.08