![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein automated matches [190329] (10 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [374004] (7 PDB entries) |
![]() | Domain d6ryja_: 6ryj A: [375881] automated match to d4dn8a1 complexed with ca, edo |
PDB Entry: 6ryj (more details), 1.25 Å
SCOPe Domain Sequences for d6ryja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ryja_ d.169.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm ndistegrftyptgeilvysnwadgepnnsdegqpencveifpdgkwndvpcskqllvic ef
Timeline for d6ryja_: