Lineage for d6ryja_ (6ryj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001815Protein automated matches [190329] (10 species)
    not a true protein
  7. 3001823Species Cow (Bos taurus) [TaxId:9913] [374004] (7 PDB entries)
  8. 3001828Domain d6ryja_: 6ryj A: [375881]
    automated match to d4dn8a1
    complexed with ca, edo

Details for d6ryja_

PDB Entry: 6ryj (more details), 1.25 Å

PDB Description: structure of conglutinin carbohydrate recognition domain with ethylene glycol bound
PDB Compounds: (A:) Conglutinin

SCOPe Domain Sequences for d6ryja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ryja_ d.169.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm
ndistegrftyptgeilvysnwadgepnnsdegqpencveifpdgkwndvpcskqllvic
ef

SCOPe Domain Coordinates for d6ryja_:

Click to download the PDB-style file with coordinates for d6ryja_.
(The format of our PDB-style files is described here.)

Timeline for d6ryja_: