Lineage for d1fwla1 (1fwl A:5-167)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2500239Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2500240Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2500678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 protein domains)
  6. 2500705Protein Homoserine kinase [54233] (1 species)
  7. 2500706Species Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries)
  8. 2500713Domain d1fwla1: 1fwl A:5-167 [37580]
    Other proteins in same PDB: d1fwla2, d1fwlb2, d1fwlc2, d1fwld2

Details for d1fwla1

PDB Entry: 1fwl (more details), 2.25 Å

PDB Description: crystal structure of homoserine kinase
PDB Compounds: (A:) homoserine kinase

SCOPe Domain Sequences for d1fwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwla1 d.14.1.5 (A:5-167) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipid

SCOPe Domain Coordinates for d1fwla1:

Click to download the PDB-style file with coordinates for d1fwla1.
(The format of our PDB-style files is described here.)

Timeline for d1fwla1: