Lineage for d1fwkd1 (1fwk D:5-167)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499246Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 499247Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 499383Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)
  6. 499403Protein Homoserine kinase [54233] (1 species)
  7. 499404Species Archaeon Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries)
  8. 499414Domain d1fwkd1: 1fwk D:5-167 [37579]
    Other proteins in same PDB: d1fwka2, d1fwkb2, d1fwkc2, d1fwkd2
    CASP4

Details for d1fwkd1

PDB Entry: 1fwk (more details), 2.1 Å

PDB Description: crystal structure of homoserine kinase complexed with adp

SCOP Domain Sequences for d1fwkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwkd1 d.14.1.5 (D:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii}
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipid

SCOP Domain Coordinates for d1fwkd1:

Click to download the PDB-style file with coordinates for d1fwkd1.
(The format of our PDB-style files is described here.)

Timeline for d1fwkd1: