Lineage for d1fwka1 (1fwk A:5-167)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157803Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 protein domains)
  6. 2157830Protein Homoserine kinase [54233] (1 species)
  7. 2157831Species Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries)
  8. 2157838Domain d1fwka1: 1fwk A:5-167 [37576]
    Other proteins in same PDB: d1fwka2, d1fwkb2, d1fwkc2, d1fwkd2
    CASP4
    complexed with adp, mg

Details for d1fwka1

PDB Entry: 1fwk (more details), 2.1 Å

PDB Description: crystal structure of homoserine kinase complexed with adp
PDB Compounds: (A:) homoserine kinase

SCOPe Domain Sequences for d1fwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwka1 d.14.1.5 (A:5-167) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipid

SCOPe Domain Coordinates for d1fwka1:

Click to download the PDB-style file with coordinates for d1fwka1.
(The format of our PDB-style files is described here.)

Timeline for d1fwka1: