Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.145: NadA-like [142753] (1 superfamily) duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134 |
Superfamily c.145.1: NadA-like [142754] (2 families) automatically mapped to Pfam PF02445 |
Family c.145.1.1: NadA-like [142755] (1 protein) Pfam PF02445 |
Protein Quinolinate synthetase A, NadA [142756] (2 species) |
Species Pyrococcus horikoshii [TaxId:70601] [319156] (12 PDB entries) |
Domain d6nsoa_: 6nso A: [375726] automated match to d1wzua1 complexed with 13p, sf4 |
PDB Entry: 6nso (more details), 1.6 Å
SCOPe Domain Sequences for d6nsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nsoa_ c.145.1.1 (A:) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 70601]} mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems
Timeline for d6nsoa_: