Lineage for d1e3ha2 (1e3h A:3-151)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598334Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (2 proteins)
  6. 598335Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)
    duplication of two-domain units formed by domains 1-2 and 4-5
  7. 598336Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)
  8. 598337Domain d1e3ha2: 1e3h A:3-151 [37572]
    Other proteins in same PDB: d1e3ha1, d1e3ha4, d1e3ha5, d1e3ha6

Details for d1e3ha2

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ha2 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus}
nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
timalnpdhlydvvainaasastqlaglp

SCOP Domain Coordinates for d1e3ha2:

Click to download the PDB-style file with coordinates for d1e3ha2.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha2: