Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (22 species) not a true protein |
Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries) |
Domain d6mz3a1: 6mz3 A:4-224 [375710] Other proteins in same PDB: d6mz3a2 automated match to d3srya_ mutant |
PDB Entry: 6mz3 (more details), 1.09 Å
SCOPe Domain Sequences for d6mz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mz3a1 d.22.1.1 (A:4-224) automated matches {Coral (Discosoma sp.) [TaxId: 86600]} nmaiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilsp qfgygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvk lrgtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttyka kkpvqlpgaynvniklditshnedytiveqyeraegrhstg
Timeline for d6mz3a1: