Lineage for d6mz3a1 (6mz3 A:4-224)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547337Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries)
  8. 2547341Domain d6mz3a1: 6mz3 A:4-224 [375710]
    Other proteins in same PDB: d6mz3a2
    automated match to d3srya_
    mutant

Details for d6mz3a1

PDB Entry: 6mz3 (more details), 1.09 Å

PDB Description: mcherry ph sensitive mutant - m66t (mcherrytyg)
PDB Compounds: (A:) PAmCherry1 protein

SCOPe Domain Sequences for d6mz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mz3a1 d.22.1.1 (A:4-224) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nmaiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilsp
qfgygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvk
lrgtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttyka
kkpvqlpgaynvniklditshnedytiveqyeraegrhstg

SCOPe Domain Coordinates for d6mz3a1:

Click to download the PDB-style file with coordinates for d6mz3a1.
(The format of our PDB-style files is described here.)

Timeline for d6mz3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mz3a2