Lineage for d1bkna1 (1bkn A:217-331)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157558Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 protein domains)
  6. 2157566Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 2157567Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)
  8. 2157573Domain d1bkna1: 1bkn A:217-331 [37568]
    Other proteins in same PDB: d1bkna2, d1bknb2

Details for d1bkna1

PDB Entry: 1bkn (more details), 2.9 Å

PDB Description: crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl
PDB Compounds: (A:) mutl

SCOPe Domain Sequences for d1bkna1:

Sequence, based on SEQRES records: (download)

>d1bkna1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

Sequence, based on observed residues (ATOM records): (download)

>d1bkna1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvsrlvhdfiyqgvlsvlq

SCOPe Domain Coordinates for d1bkna1:

Click to download the PDB-style file with coordinates for d1bkna1.
(The format of our PDB-style files is described here.)

Timeline for d1bkna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bkna2