Lineage for d1b62a1 (1b62 A:217-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930264Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 2930272Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 2930273Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)
  8. 2930276Domain d1b62a1: 1b62 A:217-332 [37567]
    Other proteins in same PDB: d1b62a2, d1b62a3
    protein/DNA complex; complexed with adp, mg

Details for d1b62a1

PDB Entry: 1b62 (more details), 2.1 Å

PDB Description: mutl complexed with adp
PDB Compounds: (A:) protein (mutl)

SCOPe Domain Sequences for d1b62a1:

Sequence, based on SEQRES records: (download)

>d1b62a1 d.14.1.3 (A:217-332) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlqq

Sequence, based on observed residues (ATOM records): (download)

>d1b62a1 d.14.1.3 (A:217-332) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpkhevrfhqsrlvhdfiyqgvlsvlqq

SCOPe Domain Coordinates for d1b62a1:

Click to download the PDB-style file with coordinates for d1b62a1.
(The format of our PDB-style files is described here.)

Timeline for d1b62a1: