Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins) |
Protein DNA mismatch repair protein MutL [54225] (1 species) |
Species Escherichia coli [TaxId:562] [54226] (6 PDB entries) |
Domain d1b63a1: 1b63 A:217-331 [37566] Other proteins in same PDB: d1b63a2, d1b63a3 protein/DNA complex; complexed with anp, edo, mg |
PDB Entry: 1b63 (more details), 1.9 Å
SCOPe Domain Sequences for d1b63a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq
Timeline for d1b63a1: