SCOPe 2.06: Domain d1b63a1: 1b63 A:217-331

Lineage for d1b63a1 (1b63 A:217-331)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)

6. Protein DNA mismatch repair protein MutL [54225] (1 species)

7. Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)

8. Domain d1b63a1: 1b63 A:217-331 [37566]
   Other proteins in same PDB: d1b63a2, d1b63a3
   protein/DNA complex; complexed with anp, edo, mg

Details for d1b63a1

PDB Entry: 1b63, 1.9 Å

PDB Description: mutl complexed with adpnp

PDB Compounds: (A:) mutl

SCOPe Domain Sequences for d1b63a1:

Sequence; same for both SEQRES and ATOM records:

>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

Timeline for d1b63a1:

• d1b63a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b63a1 appears in SCOPe 2.05
  
• d1b63a1 appears in SCOPe 2.07
  
• d1b63a1 appears in the current release, SCOPe 2.08