Lineage for d1b63a1 (1b63 A:217-331)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30320Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 30321Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 30354Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (2 proteins)
  6. 30359Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 30360Species Escherichia coli [TaxId:562] [54226] (3 PDB entries)
  8. 30361Domain d1b63a1: 1b63 A:217-331 [37566]
    Other proteins in same PDB: d1b63a2

Details for d1b63a1

PDB Entry: 1b63 (more details), 1.9 Å

PDB Description: mutl complexed with adpnp

SCOP Domain Sequences for d1b63a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

SCOP Domain Coordinates for d1b63a1:

Click to download the PDB-style file with coordinates for d1b63a1.
(The format of our PDB-style files is described here.)

Timeline for d1b63a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b63a2