Lineage for d1b63a1 (1b63 A:217-331)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) 
Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (2 proteins) Protein DNA mismatch repair protein MutL [54225] (1 species) Species Escherichia coli [TaxId:562] [54226] (3 PDB entries) 
Domain d1b63a1: 1b63 A:217-331 [37566]
Other proteins in same PDB: d1b63a2
Details for d1b63a1
PDB Entry: 1b63 (more details), 1.9 Å
PDB Description: mutl complexed with adpnp
SCOP Domain Sequences for d1b63a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq
SCOP Domain Coordinates for d1b63a1:
Click to download the PDB-style file with coordinates for d1b63a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b63a1:
- d1b63a1 appears in SCOP 1.57
- d1b63a1 appears in the current release, SCOPe 2.08
View in 3D
