![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein automated matches [231469] (5 species) not a true protein |
![]() | Species Gallus gallus [TaxId:9031] [375657] (7 PDB entries) |
![]() | Domain d6myrb2: 6myr B:115-247 [375658] Other proteins in same PDB: d6myrb1, d6myrd_ automated match to d1yq3b2 complexed with 3pe, bog, f3s, fad, fes, hem, k, k7g, oaa, peg, sf4, umq, unl |
PDB Entry: 6myr (more details), 2.15 Å
SCOPe Domain Sequences for d6myrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6myrb2 a.1.2.1 (B:115-247) automated matches {Gallus gallus [TaxId: 9031]} lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka iaeikkmmatyke
Timeline for d6myrb2: