Lineage for d1d6ta_ (1d6t A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716784Family d.14.1.2: RNase P protein [54220] (1 protein)
  6. 716785Protein RNase P protein [54221] (3 species)
  7. 716788Species Staphylococcus aureus [TaxId:1280] [54223] (1 PDB entry)
  8. 716789Domain d1d6ta_: 1d6t A: [37565]

Details for d1d6ta_

PDB Entry: 1d6t (more details)

PDB Description: rnase p protein from staphylococcus aureus
PDB Compounds: (A:) ribonuclease p

SCOP Domain Sequences for d1d6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ta_ d.14.1.2 (A:) RNase P protein {Staphylococcus aureus [TaxId: 1280]}
mllekayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrn
kikrairenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfnkkik

SCOP Domain Coordinates for d1d6ta_:

Click to download the PDB-style file with coordinates for d1d6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1d6ta_: