Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.0: automated matches [254199] (1 protein) not a true family |
Protein automated matches [254436] (5 species) not a true protein |
Species Paenibacillus macerans [TaxId:44252] [256326] (4 PDB entries) |
Domain d6l2ha4: 6l2h A:616-718 [375640] Other proteins in same PDB: d6l2ha1, d6l2ha2, d6l2ha3 automated match to d4jcla4 complexed with ca; mutant |
PDB Entry: 6l2h (more details), 2.1 Å
SCOPe Domain Sequences for d6l2ha4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l2ha4 b.3.1.0 (A:616-718) automated matches {Paenibacillus macerans [TaxId: 44252]} gdqvtmrflvnqantnygtnvylvgnaaelgswdpnkaigpmynqviakypswyydvsvp agtkldfkfikkgggtvtwegggnhtyttpassvgtvtvdwqn
Timeline for d6l2ha4: