Lineage for d6l2ha4 (6l2h A:616-718)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768737Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2768738Protein automated matches [254436] (5 species)
    not a true protein
  7. 2768760Species Paenibacillus macerans [TaxId:44252] [256326] (4 PDB entries)
  8. 2768763Domain d6l2ha4: 6l2h A:616-718 [375640]
    Other proteins in same PDB: d6l2ha1, d6l2ha2, d6l2ha3
    automated match to d4jcla4
    complexed with ca; mutant

Details for d6l2ha4

PDB Entry: 6l2h (more details), 2.1 Å

PDB Description: cgtase mutant-y167h
PDB Compounds: (A:) Alpha-cyclodextrin glucanotransferase

SCOPe Domain Sequences for d6l2ha4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l2ha4 b.3.1.0 (A:616-718) automated matches {Paenibacillus macerans [TaxId: 44252]}
gdqvtmrflvnqantnygtnvylvgnaaelgswdpnkaigpmynqviakypswyydvsvp
agtkldfkfikkgggtvtwegggnhtyttpassvgtvtvdwqn

SCOPe Domain Coordinates for d6l2ha4:

Click to download the PDB-style file with coordinates for d6l2ha4.
(The format of our PDB-style files is described here.)

Timeline for d6l2ha4: