Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.2: RNase P protein [54220] (1 protein) automatically mapped to Pfam PF00825 |
Protein RNase P protein [54221] (3 species) |
Species Bacillus subtilis [TaxId:1423] [54222] (1 PDB entry) |
Domain d1a6fa_: 1a6f A: [37564] complexed with so4, zn |
PDB Entry: 1a6f (more details), 2.6 Å
SCOPe Domain Sequences for d1a6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6fa_ d.14.1.2 (A:) RNase P protein {Bacillus subtilis [TaxId: 1423]} ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmrn rikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslyk
Timeline for d1a6fa_: